PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04632.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 267aa    MW: 30839.9 Da    PI: 10.374
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04632.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161661147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ed +l+++v  +G++ W+ Iar+m+ gRt+k+c++rw++ 
  Rsa1.0_04632.1_g00002.1 16 RGHWKPSEDSKLKELVGVFGPKKWNHIARKMQ-GRTGKSCRLRWFNQ 61
                             899*****************************.***********996 PP

2Myb_DNA-binding537.8e-1768110145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + ++++eE+e+l+ +++ +G++ W++Ia+ ++ gRt++ +k++w+
  Rsa1.0_04632.1_g00002.1  68 KSAFSEEEEEKLLAVHTTFGNK-WSLIAKLFP-GRTDNAVKNHWH 110
                              578*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9641162IPR017930Myb domain
SMARTSM007171.9E-131564IPR001005SANT/Myb domain
PfamPF002497.1E-151661IPR001005SANT/Myb domain
SuperFamilySSF466893.71E-2816113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-251769IPR009057Homeodomain-like
CDDcd001671.56E-111960No hitNo description
PROSITE profilePS5129425.07563117IPR017930Myb domain
SMARTSM007171.2E-1367115IPR001005SANT/Myb domain
PfamPF002494.4E-1468110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2170117IPR009057Homeodomain-like
CDDcd001674.40E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MHQENKRKQL SKVCTRGHWK PSEDSKLKEL VGVFGPKKWN HIARKMQGRT GKSCRLRWFN  60
QLDPRITKSA FSEEEEEKLL AVHTTFGNKW SLIAKLFPGR TDNAVKNHWH ILMARKMRKQ  120
SASYSKSRKR QVPSPHEITS MNLQPTFNLF PGRVGDERTE LKNYSWKMPK EESANLRDQF  180
LLEEYCSMRM SMQYLGHHHH QHDFSTFPTD SVEQLTRRYI SNSQPSSSSP SPTSALSTSG  240
AENTVVANYT EITEPPRFID FLGVGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-32811719128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613545.11e-158PREDICTED: transcriptional activator Myb-like
TrEMBLA0A078GYN31e-154A0A078GYN3_BRANA; BnaC04g31750D protein
STRINGBra025652.1-P1e-149(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.29e-93myb domain protein 110